CRTC3 monoclonal antibody (M05), clone 1D9
  • CRTC3 monoclonal antibody (M05), clone 1D9

CRTC3 monoclonal antibody (M05), clone 1D9

Ref: AB-H00064784-M05
CRTC3 monoclonal antibody (M05), clone 1D9

Información del producto

CRTC3 monoclonal antibody (M05), clone 1D9
Información adicional
Size 100 ug
Gene Name CRTC3
Gene Alias FLJ21868|TORC3
Gene Description CREB regulated transcription coactivator 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRTC3 (NP_073606.2, 176 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64784
Clone Number 1D9
Iso type IgG1 Kappa

Enviar un mensaje


CRTC3 monoclonal antibody (M05), clone 1D9

CRTC3 monoclonal antibody (M05), clone 1D9