CERK polyclonal antibody (A01)
  • CERK polyclonal antibody (A01)

CERK polyclonal antibody (A01)

Ref: AB-H00064781-A01
CERK polyclonal antibody (A01)

Información del producto

CERK polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name CERK
Gene Alias DKFZp434E0211|FLJ21430|FLJ23239|KIAA1646|LK4|MGC131878|dA59H18.2|dA59H18.3|hCERK
Gene Description ceramide kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CERK (AAH04278, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64781

Enviar un mensaje


CERK polyclonal antibody (A01)

CERK polyclonal antibody (A01)