IPPK purified MaxPab mouse polyclonal antibody (B01P)
  • IPPK purified MaxPab mouse polyclonal antibody (B01P)

IPPK purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064768-B01P
IPPK purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

IPPK purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name IPPK
Gene Alias C9orf12|FLJ13163|INSP5K2|IP5K|IPK1|KIAA0699|bA476B13.1
Gene Description inositol 1,3,4,5,6-pentakisphosphate 2-kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGKNVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPKCGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIYGCKDARSPVADWSELAHHLKPFFFPSNGLASGPHCTR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IPPK (NP_073592.1, 1 a.a. ~ 491 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64768

Enviar un mensaje


IPPK purified MaxPab mouse polyclonal antibody (B01P)

IPPK purified MaxPab mouse polyclonal antibody (B01P)