IPPK polyclonal antibody (A01)
  • IPPK polyclonal antibody (A01)

IPPK polyclonal antibody (A01)

Ref: AB-H00064768-A01
IPPK polyclonal antibody (A01)

Información del producto

IPPK polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name IPPK
Gene Alias C9orf12|FLJ13163|INSP5K2|IP5K|IPK1|KIAA0699|bA476B13.1
Gene Description inositol 1,3,4,5,6-pentakisphosphate 2-kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IPPK (NP_073592, 391 a.a. ~ 491 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64768

Enviar un mensaje


IPPK polyclonal antibody (A01)

IPPK polyclonal antibody (A01)