CREB3L2 monoclonal antibody (M03), clone 1B8
  • CREB3L2 monoclonal antibody (M03), clone 1B8

CREB3L2 monoclonal antibody (M03), clone 1B8

Ref: AB-H00064764-M03
CREB3L2 monoclonal antibody (M03), clone 1B8

Información del producto

CREB3L2 monoclonal antibody (M03), clone 1B8
Información adicional
Size 100 ug
Gene Name CREB3L2
Gene Alias BBF2H7|MGC131709|MGC71006
Gene Description cAMP responsive element binding protein 3-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREB3L2 (NP_919047.2, 421 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64764
Clone Number 1B8
Iso type IgG2a Kappa

Enviar un mensaje


CREB3L2 monoclonal antibody (M03), clone 1B8

CREB3L2 monoclonal antibody (M03), clone 1B8