UNKL purified MaxPab mouse polyclonal antibody (B01P)
  • UNKL purified MaxPab mouse polyclonal antibody (B01P)

UNKL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064718-B01P
UNKL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UNKL protein.
Información adicional
Size 50 ug
Gene Name UNKL
Gene Alias C16orf28|FLJ12623|FLJ23360|KIAA0734|MGC5179|ZC3H5L|ZC3HDC5L
Gene Description unkempt homolog (Drosophila)-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UNKL (NP_001032202, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64718

Enviar un mensaje


UNKL purified MaxPab mouse polyclonal antibody (B01P)

UNKL purified MaxPab mouse polyclonal antibody (B01P)