GORASP1 purified MaxPab mouse polyclonal antibody (B01P)
  • GORASP1 purified MaxPab mouse polyclonal antibody (B01P)

GORASP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064689-B01P
GORASP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

GORASP1 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name GORASP1
Gene Alias FLJ23443|GOLPH5|GRASP65|MGC118894|MGC118897|P65
Gene Description golgi reassembly stacking protein 1, 65kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYME
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GORASP1 (NP_114105.1, 1 a.a. ~ 440 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64689

Enviar un mensaje


GORASP1 purified MaxPab mouse polyclonal antibody (B01P)

GORASP1 purified MaxPab mouse polyclonal antibody (B01P)