PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)
  • PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)

PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064600-B01P
PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name PLA2G2F
Gene Alias FLJ25429|FLJ36326
Gene Description phospholipase A2, group IIF
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGMKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVYCQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLA2G2F (NP_073730.3, 1 a.a. ~ 211 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64600

Enviar un mensaje


PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)

PLA2G2F purified MaxPab mouse polyclonal antibody (B01P)