NDST4 polyclonal antibody (A01)
  • NDST4 polyclonal antibody (A01)

NDST4 polyclonal antibody (A01)

Ref: AB-H00064579-A01
NDST4 polyclonal antibody (A01)

Información del producto

NDST4 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name NDST4
Gene Alias -
Gene Description N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDST4 (NP_072091, 122 a.a. ~ 214 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64579

Enviar un mensaje


NDST4 polyclonal antibody (A01)

NDST4 polyclonal antibody (A01)