DNAI2 MaxPab rabbit polyclonal antibody (D01)
  • DNAI2 MaxPab rabbit polyclonal antibody (D01)

DNAI2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00064446-D01
DNAI2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

DNAI2 MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name DNAI2
Gene Alias CILD9
Gene Description dynein, axonemal, intermediate chain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNAI2 (AAH39582.1, 1 a.a. ~ 593 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 64446

Enviar un mensaje


DNAI2 MaxPab rabbit polyclonal antibody (D01)

DNAI2 MaxPab rabbit polyclonal antibody (D01)