APG3L polyclonal antibody (A01)
  • APG3L polyclonal antibody (A01)

APG3L polyclonal antibody (A01)

Ref: AB-H00064422-A01
APG3L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant APG3L.
Información adicional
Size 50 uL
Gene Name ATG3
Gene Alias APG3|APG3-LIKE|APG3L|DKFZp564M1178|FLJ22125|MGC15201|PC3-96
Gene Description ATG3 autophagy related 3 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APG3L (NP_071933, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64422

Enviar un mensaje


APG3L polyclonal antibody (A01)

APG3L polyclonal antibody (A01)