HHIP monoclonal antibody (M01), clone 5D11
  • HHIP monoclonal antibody (M01), clone 5D11

HHIP monoclonal antibody (M01), clone 5D11

Ref: AB-H00064399-M01
HHIP monoclonal antibody (M01), clone 5D11

Información del producto

HHIP monoclonal antibody (M01), clone 5D11
Información adicional
Size 100 ug
Gene Name HHIP
Gene Alias FLJ20992|FLJ90230|HIP|STQTL12
Gene Description hedgehog interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64399
Clone Number 5D11
Iso type IgG2b Kappa

Enviar un mensaje


HHIP monoclonal antibody (M01), clone 5D11

HHIP monoclonal antibody (M01), clone 5D11