HHIP purified MaxPab rabbit polyclonal antibody (D01P)
  • HHIP purified MaxPab rabbit polyclonal antibody (D01P)

HHIP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064399-D01P
HHIP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

HHIP purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name HHIP
Gene Alias FLJ20992|FLJ90230|HIP|STQTL12
Gene Description hedgehog interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HHIP (NP_071920.1, 1 a.a. ~ 700 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64399

Enviar un mensaje


HHIP purified MaxPab rabbit polyclonal antibody (D01P)

HHIP purified MaxPab rabbit polyclonal antibody (D01P)