MPP5 polyclonal antibody (A01)
  • MPP5 polyclonal antibody (A01)

MPP5 polyclonal antibody (A01)

Ref: AB-H00064398-A01
MPP5 polyclonal antibody (A01)

Información del producto

MPP5 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name MPP5
Gene Alias FLJ12615|PALS1
Gene Description membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPP5 (NP_071919, 79 a.a. ~ 177 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64398

Enviar un mensaje


MPP5 polyclonal antibody (A01)

MPP5 polyclonal antibody (A01)