IKZF4 MaxPab rabbit polyclonal antibody (D01)
  • IKZF4 MaxPab rabbit polyclonal antibody (D01)

IKZF4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00064375-D01
IKZF4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

IKZF4 MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name IKZF4
Gene Alias EOS|KIAA1782|ZNFN1A4
Gene Description IKAROS family zinc finger 4 (Eos)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IKZF4 (ENSP00000262032, 1 a.a. ~ 544 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 64375

Enviar un mensaje


IKZF4 MaxPab rabbit polyclonal antibody (D01)

IKZF4 MaxPab rabbit polyclonal antibody (D01)