ARHGAP9 purified MaxPab mouse polyclonal antibody (B01P)
  • ARHGAP9 purified MaxPab mouse polyclonal antibody (B01P)

ARHGAP9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064333-B01P
ARHGAP9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARHGAP9 protein.
Información adicional
Size 50 ug
Gene Name ARHGAP9
Gene Alias 10C|FLJ16525|MGC1295|RGL1
Gene Description Rho GTPase activating protein 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSDWWLARRLEAPSTSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQALPSRAQASSEQPPPLPRKMCRSVSTDNLSPSFLKPFQEGPSGRSLSQEDLPSEASASTAGPQPLMSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGAP9 (AAH06107.1, 1 a.a. ~ 750 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64333

Enviar un mensaje


ARHGAP9 purified MaxPab mouse polyclonal antibody (B01P)

ARHGAP9 purified MaxPab mouse polyclonal antibody (B01P)