LMBR1 monoclonal antibody (M05), clone 4A1
  • LMBR1 monoclonal antibody (M05), clone 4A1

LMBR1 monoclonal antibody (M05), clone 4A1

Ref: AB-H00064327-M05
LMBR1 monoclonal antibody (M05), clone 4A1

Información del producto

LMBR1 monoclonal antibody (M05), clone 4A1
Información adicional
Size 100 ug
Gene Name LMBR1
Gene Alias ACHP|C7orf2|DIF14|FLJ11665|PPD2|TPT
Gene Description limb region 1 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LMBR1 (NP_071903, 214 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64327
Clone Number 4A1
Iso type IgG2a Kappa

Enviar un mensaje


LMBR1 monoclonal antibody (M05), clone 4A1

LMBR1 monoclonal antibody (M05), clone 4A1