NSD1 monoclonal antibody (M06), clone 3E6
  • NSD1 monoclonal antibody (M06), clone 3E6

NSD1 monoclonal antibody (M06), clone 3E6

Ref: AB-H00064324-M06
NSD1 monoclonal antibody (M06), clone 3E6

Información del producto

NSD1 monoclonal antibody (M06), clone 3E6
Información adicional
Size 100 ug
Gene Name NSD1
Gene Alias ARA267|DKFZp666C163|FLJ10684|FLJ22263|FLJ44628|KMT3B|SOTOS|STO
Gene Description nuclear receptor binding SET domain protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NSD1 (NP_071900, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64324
Clone Number 3E6
Iso type IgG2b Kappa

Enviar un mensaje


NSD1 monoclonal antibody (M06), clone 3E6

NSD1 monoclonal antibody (M06), clone 3E6