NOC3L monoclonal antibody (M04), clone 5E8
  • NOC3L monoclonal antibody (M04), clone 5E8

NOC3L monoclonal antibody (M04), clone 5E8

Ref: AB-H00064318-M04
NOC3L monoclonal antibody (M04), clone 5E8

Información del producto

NOC3L monoclonal antibody (M04), clone 5E8
Información adicional
Size 100 ug
Gene Name NOC3L
Gene Alias AD24|C10orf117|FAD24|FLJ12820
Gene Description nucleolar complex associated 3 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOC3L (NP_071896, 702 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64318
Clone Number 5E8
Iso type IgG1 Kappa

Enviar un mensaje


NOC3L monoclonal antibody (M04), clone 5E8

NOC3L monoclonal antibody (M04), clone 5E8