MLST8 purified MaxPab rabbit polyclonal antibody (D01P)
  • MLST8 purified MaxPab rabbit polyclonal antibody (D01P)

MLST8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064223-D01P
MLST8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

MLST8 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name MLST8
Gene Alias GBL|LST8|POP3|WAT1|GbetaL
Gene Description MTOR associated protein, LST8 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MLST8 (NP_071767.3, 1 a.a. ~ 326 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64223

Enviar un mensaje


MLST8 purified MaxPab rabbit polyclonal antibody (D01P)

MLST8 purified MaxPab rabbit polyclonal antibody (D01P)