TOR3A MaxPab mouse polyclonal antibody (B01P)
  • TOR3A MaxPab mouse polyclonal antibody (B01P)

TOR3A MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064222-B01P
TOR3A MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOR3A protein.
Información adicional
Size 50 ug
Gene Name TOR3A
Gene Alias ADIR|ADIR2|FLJ22345|MGC111104
Gene Description torsin family 3, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLRGPWRQLWLFLLLLLPGAPEPRGASRPWEGTDEPGSAWAWPGFQRLQEQLRAAGALSKRYWTLFSCQVWPDDCDEDEEAATGPLGWRLPLLGQRYLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLVQQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOR3A (AAH11746.1, 1 a.a. ~ 397 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64222

Enviar un mensaje


TOR3A MaxPab mouse polyclonal antibody (B01P)

TOR3A MaxPab mouse polyclonal antibody (B01P)