STRA6 purified MaxPab rabbit polyclonal antibody (D01P)
  • STRA6 purified MaxPab rabbit polyclonal antibody (D01P)

STRA6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064220-D01P
STRA6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

STRA6 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name STRA6
Gene Alias FLJ12541|MCOPS9|PP14296
Gene Description stimulated by retinoic acid gene 6 homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPGLYHACLASLSILVLLLLAMLVRRRQLWPDCVRGRPGLPSPVDFLAGDRPRAVPAAVFMVLLSSLCLLLPDEDALPFLTLASAPSQDGKTEAPRGAWKILGLFYYAALYYPLAACATAGHTAAHLLGSTLSWAHLGVQVWQRAECPQVPKIYKYYSLLASLPLLLGLGFLSLWYPVQLVRSFSRRTGAGSKGLQSSYSEEYLRNLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STRA6 (AAH25256.1, 1 a.a. ~ 667 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64220

Enviar un mensaje


STRA6 purified MaxPab rabbit polyclonal antibody (D01P)

STRA6 purified MaxPab rabbit polyclonal antibody (D01P)