SEMA4A monoclonal antibody (M02), clone 4E2
  • SEMA4A monoclonal antibody (M02), clone 4E2

SEMA4A monoclonal antibody (M02), clone 4E2

Ref: AB-H00064218-M02
SEMA4A monoclonal antibody (M02), clone 4E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEMA4A.
Información adicional
Size 100 ug
Gene Name SEMA4A
Gene Alias CORD10|FLJ12287|RP35|SEMAB|SEMB
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA4A (NP_071762, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64218
Clone Number 4E2
Iso type IgG2a Kappa

Enviar un mensaje


SEMA4A monoclonal antibody (M02), clone 4E2

SEMA4A monoclonal antibody (M02), clone 4E2