SEMA4A purified MaxPab rabbit polyclonal antibody (D01P)
  • SEMA4A purified MaxPab rabbit polyclonal antibody (D01P)

SEMA4A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064218-D01P
SEMA4A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SEMA4A protein.
Información adicional
Size 100 ug
Gene Name SEMA4A
Gene Alias CORD10|FLJ12287|RP35|SEMAB|SEMB
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEMA4A (NP_071762.2, 1 a.a. ~ 761 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64218

Enviar un mensaje


SEMA4A purified MaxPab rabbit polyclonal antibody (D01P)

SEMA4A purified MaxPab rabbit polyclonal antibody (D01P)