TFB2M polyclonal antibody (A01)
  • TFB2M polyclonal antibody (A01)

TFB2M polyclonal antibody (A01)

Ref: AB-H00064216-A01
TFB2M polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TFB2M.
Información adicional
Size 50 uL
Gene Name TFB2M
Gene Alias FLJ22661|FLJ23182|Hkp1
Gene Description transcription factor B2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq YLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFB2M (NP_071761, 297 a.a. ~ 396 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64216

Enviar un mensaje


TFB2M polyclonal antibody (A01)

TFB2M polyclonal antibody (A01)