NECAB1 purified MaxPab mouse polyclonal antibody (B01P)
  • NECAB1 purified MaxPab mouse polyclonal antibody (B01P)

NECAB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064168-B01P
NECAB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NECAB1 protein.
Información adicional
Size 50 ug
Gene Name NECAB1
Gene Alias EFCBP1|STIP-1
Gene Description N-terminal EF-hand calcium binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSGPGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NECAB1 (NP_071746.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64168

Enviar un mensaje


NECAB1 purified MaxPab mouse polyclonal antibody (B01P)

NECAB1 purified MaxPab mouse polyclonal antibody (B01P)