KIF9 monoclonal antibody (M07), clone 4E9
  • KIF9 monoclonal antibody (M07), clone 4E9

KIF9 monoclonal antibody (M07), clone 4E9

Ref: AB-H00064147-M07
KIF9 monoclonal antibody (M07), clone 4E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KIF9.
Información adicional
Size 100 ug
Gene Name KIF9
Gene Alias MGC104186
Gene Description kinesin family member 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIF9 (NP_878905.1, 691 a.a. ~ 789 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64147
Clone Number 4E9
Iso type IgG2a Kappa

Enviar un mensaje


KIF9 monoclonal antibody (M07), clone 4E9

KIF9 monoclonal antibody (M07), clone 4E9