IFIH1 MaxPab rabbit polyclonal antibody (D01)
  • IFIH1 MaxPab rabbit polyclonal antibody (D01)

IFIH1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00064135-D01
IFIH1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFIH1 protein.
Información adicional
Size 100 uL
Gene Name IFIH1
Gene Alias Hlcd|IDDM19|MDA-5|MDA5|MGC133047
Gene Description interferon induced with helicase C domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFIH1 (AAH46208.1, 1 a.a. ~ 221 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 64135

Enviar un mensaje


IFIH1 MaxPab rabbit polyclonal antibody (D01)

IFIH1 MaxPab rabbit polyclonal antibody (D01)