IFIH1 purified MaxPab mouse polyclonal antibody (B01P)
  • IFIH1 purified MaxPab mouse polyclonal antibody (B01P)

IFIH1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064135-B01P
IFIH1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IFIH1 protein.
Información adicional
Size 50 ug
Gene Name IFIH1
Gene Alias Hlcd|IDDM19|MDA-5|MDA5|MGC133047
Gene Description interferon induced with helicase C domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFIH1 (AAH46208.1, 1 a.a. ~ 221 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64135

Enviar un mensaje


IFIH1 purified MaxPab mouse polyclonal antibody (B01P)

IFIH1 purified MaxPab mouse polyclonal antibody (B01P)