EPB41L4A MaxPab mouse polyclonal antibody (B01)
  • EPB41L4A MaxPab mouse polyclonal antibody (B01)

EPB41L4A MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00064097-B01
EPB41L4A MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human EPB41L4A protein.
Información adicional
Size 50 uL
Gene Name EPB41L4A
Gene Alias EPB41L4|FLJ38738|NBL4
Gene Description erythrocyte membrane protein band 4.1 like 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPB41L4A (AAH31042.1, 1 a.a. ~ 185 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 64097

Enviar un mensaje


EPB41L4A MaxPab mouse polyclonal antibody (B01)

EPB41L4A MaxPab mouse polyclonal antibody (B01)