SMOC1 polyclonal antibody (A01)
  • SMOC1 polyclonal antibody (A01)

SMOC1 polyclonal antibody (A01)

Ref: AB-H00064093-A01
SMOC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMOC1.
Información adicional
Size 50 uL
Gene Name SMOC1
Gene Alias -
Gene Description SPARC related modular calcium binding 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64093

Enviar un mensaje


SMOC1 polyclonal antibody (A01)

SMOC1 polyclonal antibody (A01)