MCCC2 monoclonal antibody (M05), clone 2B3
  • MCCC2 monoclonal antibody (M05), clone 2B3

MCCC2 monoclonal antibody (M05), clone 2B3

Ref: AB-H00064087-M05
MCCC2 monoclonal antibody (M05), clone 2B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MCCC2.
Información adicional
Size 100 ug
Gene Name MCCC2
Gene Alias MCCB
Gene Description methylcrotonoyl-Coenzyme A carboxylase 2 (beta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq AYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MCCC2 (NP_071415, 456 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64087
Clone Number 2B3
Iso type IgG1 Kappa

Enviar un mensaje


MCCC2 monoclonal antibody (M05), clone 2B3

MCCC2 monoclonal antibody (M05), clone 2B3