MCCC2 polyclonal antibody (A01)
  • MCCC2 polyclonal antibody (A01)

MCCC2 polyclonal antibody (A01)

Ref: AB-H00064087-A01
MCCC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MCCC2.
Información adicional
Size 50 uL
Gene Name MCCC2
Gene Alias MCCB
Gene Description methylcrotonoyl-Coenzyme A carboxylase 2 (beta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MCCC2 (NP_071415, 456 a.a. ~ 563 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64087

Enviar un mensaje


MCCC2 polyclonal antibody (A01)

MCCC2 polyclonal antibody (A01)