RBKS purified MaxPab rabbit polyclonal antibody (D01P)
  • RBKS purified MaxPab rabbit polyclonal antibody (D01P)

RBKS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064080-D01P
RBKS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RBKS protein.
Información adicional
Size 100 ug
Gene Name RBKS
Gene Alias DKFZp686G13268|RBSK
Gene Description ribokinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAASGEPQRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RBKS (NP_071411.1, 1 a.a. ~ 322 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64080

Enviar un mensaje


RBKS purified MaxPab rabbit polyclonal antibody (D01P)

RBKS purified MaxPab rabbit polyclonal antibody (D01P)