P53AIP1 polyclonal antibody (A01)
  • P53AIP1 polyclonal antibody (A01)

P53AIP1 polyclonal antibody (A01)

Ref: AB-H00063970-A01
P53AIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant P53AIP1.
Información adicional
Size 50 uL
Gene Name P53AIP1
Gene Alias -
Gene Description p53-regulated apoptosis-inducing protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen P53AIP1 (NP_071395, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 63970

Enviar un mensaje


P53AIP1 polyclonal antibody (A01)

P53AIP1 polyclonal antibody (A01)