DMRTB1 monoclonal antibody (M02), clone 5E7
  • DMRTB1 monoclonal antibody (M02), clone 5E7

DMRTB1 monoclonal antibody (M02), clone 5E7

Ref: AB-H00063948-M02
DMRTB1 monoclonal antibody (M02), clone 5E7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DMRTB1.
Información adicional
Size 100 ug
Gene Name DMRTB1
Gene Alias -
Gene Description DMRT-like family B with proline-rich C-terminal, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMRTB1 (AAH29566.1, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63948
Clone Number 5E7
Iso type IgG2a Kappa

Enviar un mensaje


DMRTB1 monoclonal antibody (M02), clone 5E7

DMRTB1 monoclonal antibody (M02), clone 5E7