DMRTB1 purified MaxPab mouse polyclonal antibody (B02P)
  • DMRTB1 purified MaxPab mouse polyclonal antibody (B02P)

DMRTB1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00063948-B02P
DMRTB1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DMRTB1 protein.
Información adicional
Size 50 ug
Gene Name DMRTB1
Gene Alias -
Gene Description DMRT-like family B with proline-rich C-terminal, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DMRTB1 (AAH29566.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63948

Enviar un mensaje


DMRTB1 purified MaxPab mouse polyclonal antibody (B02P)

DMRTB1 purified MaxPab mouse polyclonal antibody (B02P)