CIDEC monoclonal antibody (M07), clone 2E2
  • CIDEC monoclonal antibody (M07), clone 2E2

CIDEC monoclonal antibody (M07), clone 2E2

Ref: AB-H00063924-M07
CIDEC monoclonal antibody (M07), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CIDEC.
Información adicional
Size 100 ug
Gene Name CIDEC
Gene Alias CIDE-3|FLJ20871|Fsp27
Gene Description cell death-inducing DFFA-like effector c
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63924
Clone Number 2E2
Iso type IgG1 Kappa

Enviar un mensaje


CIDEC monoclonal antibody (M07), clone 2E2

CIDEC monoclonal antibody (M07), clone 2E2