UBE2O monoclonal antibody (M06), clone 2C10
  • UBE2O monoclonal antibody (M06), clone 2C10

UBE2O monoclonal antibody (M06), clone 2C10

Ref: AB-H00063893-M06
UBE2O monoclonal antibody (M06), clone 2C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2O.
Información adicional
Size 100 ug
Gene Name UBE2O
Gene Alias E2-230K|FLJ12878|KIAA1734
Gene Description ubiquitin-conjugating enzyme E2O
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGESKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2O (NP_071349.2, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63893
Clone Number 2C10
Iso type IgG2a Kappa

Enviar un mensaje


UBE2O monoclonal antibody (M06), clone 2C10

UBE2O monoclonal antibody (M06), clone 2C10