PKNOX2 purified MaxPab mouse polyclonal antibody (B01P)
  • PKNOX2 purified MaxPab mouse polyclonal antibody (B01P)

PKNOX2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00063876-B01P
PKNOX2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PKNOX2 protein.
Información adicional
Size 50 ug
Gene Name PKNOX2
Gene Alias FLJ13074|PREP2
Gene Description PBX/knotted 1 homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PKNOX2 (AAH45626.3, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63876

Enviar un mensaje


PKNOX2 purified MaxPab mouse polyclonal antibody (B01P)

PKNOX2 purified MaxPab mouse polyclonal antibody (B01P)