SRR MaxPab rabbit polyclonal antibody (D01)
  • SRR MaxPab rabbit polyclonal antibody (D01)

SRR MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00063826-D01
SRR MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SRR protein.
Información adicional
Size 100 uL
Gene Name SRR
Gene Alias ILV1|ISO1
Gene Description serine racemase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRR (NP_068766.1, 1 a.a. ~ 340 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 63826

Enviar un mensaje


SRR MaxPab rabbit polyclonal antibody (D01)

SRR MaxPab rabbit polyclonal antibody (D01)