FKBP10 monoclonal antibody (M02), clone 3B5
  • FKBP10 monoclonal antibody (M02), clone 3B5

FKBP10 monoclonal antibody (M02), clone 3B5

Ref: AB-H00060681-M02
FKBP10 monoclonal antibody (M02), clone 3B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FKBP10.
Información adicional
Size 100 ug
Gene Name FKBP10
Gene Alias FKBP6|FKBP65|FLJ20683|FLJ22041|FLJ23833|hFKBP65
Gene Description FK506 binding protein 10, 65 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60681
Clone Number 3B5
Iso type IgG2a Kappa

Enviar un mensaje


FKBP10 monoclonal antibody (M02), clone 3B5

FKBP10 monoclonal antibody (M02), clone 3B5