FKBP10 polyclonal antibody (A01)
  • FKBP10 polyclonal antibody (A01)

FKBP10 polyclonal antibody (A01)

Ref: AB-H00060681-A01
FKBP10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FKBP10.
Información adicional
Size 50 uL
Gene Name FKBP10
Gene Alias FKBP6|FKBP65|FLJ20683|FLJ22041|FLJ23833|hFKBP65
Gene Description FK506 binding protein 10, 65 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60681

Enviar un mensaje


FKBP10 polyclonal antibody (A01)

FKBP10 polyclonal antibody (A01)