RIC8A monoclonal antibody (M01), clone 1H6
  • RIC8A monoclonal antibody (M01), clone 1H6

RIC8A monoclonal antibody (M01), clone 1H6

Ref: AB-H00060626-M01
RIC8A monoclonal antibody (M01), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RIC8A.
Información adicional
Size 100 ug
Gene Name RIC8A
Gene Alias MGC104517|MGC131931|MGC148073|MGC148074|RIC8|synembryn
Gene Description resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RIC8A (NP_068751.4, 462 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60626
Clone Number 1H6
Iso type IgG2a Kappa

Enviar un mensaje


RIC8A monoclonal antibody (M01), clone 1H6

RIC8A monoclonal antibody (M01), clone 1H6