ELAC2 monoclonal antibody (M01), clone 1A2
  • ELAC2 monoclonal antibody (M01), clone 1A2

ELAC2 monoclonal antibody (M01), clone 1A2

Ref: AB-H00060528-M01
ELAC2 monoclonal antibody (M01), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ELAC2.
Información adicional
Size 100 ug
Gene Name ELAC2
Gene Alias ELC2|FLJ10530|FLJ36693|FLJ42848|HPC2
Gene Description elaC homolog 2 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq WALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELAC2 (NP_060597.3, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60528
Clone Number 1A2
Iso type IgG2a Kappa

Enviar un mensaje


ELAC2 monoclonal antibody (M01), clone 1A2

ELAC2 monoclonal antibody (M01), clone 1A2