ELAC2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ELAC2 purified MaxPab rabbit polyclonal antibody (D01P)

ELAC2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00060528-D01P
ELAC2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ELAC2 protein.
Información adicional
Size 100 ug
Gene Name ELAC2
Gene Alias ELC2|FLJ10530|FLJ36693|FLJ42848|HPC2
Gene Description elaC homolog 2 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MWALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGGLSGMILTLKETGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSPERPLSRLSPERSSDSELNENEPHLPHGVSQRRGVRDSSLVVAFICKLHLKRGNFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELAC2 (NP_060597.3, 1 a.a. ~ 826 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60528

Enviar un mensaje


ELAC2 purified MaxPab rabbit polyclonal antibody (D01P)

ELAC2 purified MaxPab rabbit polyclonal antibody (D01P)