AASDHPPT polyclonal antibody (A01)
  • AASDHPPT polyclonal antibody (A01)

AASDHPPT polyclonal antibody (A01)

Ref: AB-H00060496-A01
AASDHPPT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AASDHPPT.
Información adicional
Size 50 uL
Gene Name AASDHPPT
Gene Alias AASD-PPT|CGI-80|DKFZp566E2346|LYS2|LYS5
Gene Description aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AASDHPPT (NP_056238, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60496

Enviar un mensaje


AASDHPPT polyclonal antibody (A01)

AASDHPPT polyclonal antibody (A01)