FLJ13149 polyclonal antibody (A01)
  • FLJ13149 polyclonal antibody (A01)

FLJ13149 polyclonal antibody (A01)

Ref: AB-H00060493-A01
FLJ13149 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FLJ13149.
Información adicional
Size 50 uL
Gene Name FASTKD5
Gene Alias FLJ13149|FLJ58294|dJ1187M17.5
Gene Description FAST kinase domains 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NVADKSGAMEMAGLCPAACMQTPRMKLAVQFTNRNQYCYGSRDLLGLHNMKRRQLARLGYRVVELSYWEWLPLLKRTRLEKLAFLHEKVFTSAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLJ13149 (NP_068598, 671 a.a. ~ 764 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60493

Enviar un mensaje


FLJ13149 polyclonal antibody (A01)

FLJ13149 polyclonal antibody (A01)