SAV1 polyclonal antibody (A01)
  • SAV1 polyclonal antibody (A01)

SAV1 polyclonal antibody (A01)

Ref: AB-H00060485-A01
SAV1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SAV1.
Información adicional
Size 50 uL
Gene Name SAV1
Gene Alias SAV|WW45|WWP4
Gene Description salvador homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60485

Enviar un mensaje


SAV1 polyclonal antibody (A01)

SAV1 polyclonal antibody (A01)