TGIF2 monoclonal antibody (M06), clone 6A8
  • TGIF2 monoclonal antibody (M06), clone 6A8

TGIF2 monoclonal antibody (M06), clone 6A8

Ref: AB-H00060436-M06
TGIF2 monoclonal antibody (M06), clone 6A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TGIF2.
Información adicional
Size 100 ug
Gene Name TGIF2
Gene Alias -
Gene Description TGFB-induced factor homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60436
Clone Number 6A8
Iso type IgG2a Kappa

Enviar un mensaje


TGIF2 monoclonal antibody (M06), clone 6A8

TGIF2 monoclonal antibody (M06), clone 6A8